PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.D02123.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 471aa    MW: 52678.9 Da    PI: 9.108
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.D02123.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.81.2e-273382251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    rie+++ rqvtfskRr g++KKA+ELSvLCdaeva+i+fs++ +ly ++s
  Pahal.D02123.1 33 RIEDTTSRQVTFSKRRSGLFKKAHELSVLCDAEVALIVFSPRHRLYQFAS 82
                    8***********************************************86 PP

2K-box81.81.5e-27103196699
           K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                     +++++e   e+++ e++ L ++i+ ++  +R+llGe+L+s+s++eLq+Le qLeksl++iR++K++ l++qi el++ke++l +en +Lr + +
  Pahal.D02123.1 103 DERVDEPGVEKWKYEATTLGQKIDAIEAYKRKLLGESLGSCSIQELQELELQLEKSLSSIRQRKQKKLMDQILELRQKEQKLAKENAMLRDQCK 196
                     455888899*********************************************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.7E-362483IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.1142484IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-262646IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-2926115IPR002100Transcription factor, MADS-box
PROSITE patternPS0035002680IPR002100Transcription factor, MADS-box
PfamPF003193.0E-263380IPR002100Transcription factor, MADS-box
CDDcd002652.12E-343499No hitNo description
PRINTSPR004042.1E-264661IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-266182IPR002100Transcription factor, MADS-box
PROSITE profilePS5129714.562111201IPR002487Transcription factor, K-box
PfamPF014867.7E-27112195IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MVAAAAAAPD QRQIVPSDAS RKKGRRGRRE MRRIEDTTSR QVTFSKRRSG LFKKAHELSV  60
LCDAEVALIV FSPRHRLYQF ASATDLQNTI DRYLNHTKGT PTDERVDEPG VEKWKYEATT  120
LGQKIDAIEA YKRKLLGESL GSCSIQELQE LELQLEKSLS SIRQRKQKKL MDQILELRQK  180
EQKLAKENAM LRDQCKALPL LLLNDIKGRM DAAAGGEEEA DDGRMEDVET ELAIGIGRRW  240
PSNSIVMDKT IMSNQAGKVL KKGKKKQAKD ELDRQKQAEK KRRRLEKALA NSAAIISELE  300
KKKQKKKEEQ QRLDEEGAAI AEAVALHVLI GEDSDEPCHL MLNKHRRCSH WDPSAGFEFT  360
MDAQAADIYS SDGLICASHA YAPKGRWADW GIGQPLPSWG EVRDLQGPYY QGTFHQTVNC  420
PGFVAAQAVS SLQIREDSSE ITSPSQGAAA ATVVNRMLGG ANRLNLYREI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-1526115389Myocyte-specific enhancer factor 2B
1tqe_R1e-1526115389Myocyte-specific enhancer factor 2B
1tqe_Q1e-1526115389Myocyte-specific enhancer factor 2B
1tqe_P1e-1526115389Myocyte-specific enhancer factor 2B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1263283KKKQAKDELDRQKQAEKKRRR
2280284KRRRL
3281304RRRLEKALANSAAIISELEKKKQK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLK3Z0C20.0K3Z0C2_SETIT; Uncharacterized protein
STRINGSi019985m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38051616
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.13e-50AGAMOUS-like 20